Zu "Q9Y3E2" wurden 11 Artikel gefunden!

Für die Filterung wurden keine Ergebnisse gefunden!
Anti-BOLA1
Anti-BOLA1

Artikelnummer: E-AB-18542.120

BOLA1 (BolA Family Member 1) is a Protein Coding gene. An important paralog of this gene is BOLA2. Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with the monothiol...
Schlagworte: Anti-hBolA, Anti-BolA-like protein 1, BOLA1 Polyclonal Antibody
Anwendung: IHC, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 71,00 €
Bewerten
Anti-BOLA1
Anti-BOLA1

Artikelnummer: E-AB-52476.120

BOLA1 (BolA Family Member 1) is a Protein Coding gene. An important paralog of this gene is BOLA2. Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with the monothiol...
Schlagworte: Anti-hBolA, Anti-BolA-like protein 1, BOLA1 Polyclonal Antibody
Anwendung: IHC, ELISA
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
ab 71,00 €
Bewerten
Anti-BOLA1
Anti-BOLA1

Artikelnummer: ATA-HPA007005.100

Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with the monothiol glutaredoxin GLRX5 (PubMed:27532772). May protect cells against oxidative stress (PubMed:22746225). [The...
Schlagworte: Anti-hBolA, Anti-BolA-like protein 1
Anwendung: IHC
Wirt: Rabbit
Spezies-Reaktivität: human
ab 335,00 €
Bewerten
CGI-143, Human, Real Time PCR Primer Set
CGI-143, Human, Real Time PCR Primer Set

Artikelnummer: VHPS-1866

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: BOLA1, hBolA, BolA-like protein 1
Anwendung: RNA quantification
43,00 €
Bewerten
BOLA1, Recombinant, Human, aa21-137, His-Tag (BolA-like protein 1)
BOLA1, Recombinant, Human, aa21-137, His-Tag (BolA-like...

Artikelnummer: 349733.100

BOLA1 belongs to the bolA/yrbA family. BolA proteins (hBolA1, hBolA2, and hBolA3) are novel non-classical secreted proteins identified with bioinformatics and molecular biology experiments. The three BolA fusion proteins with c-Myc tag could be secreted into the culture medium of the transfected Cos-7 cells,...
Schlagworte: hBolA, BolA-like protein 1
Ursprungsart: human
MW: 14 kD
ab 568,00 €
Bewerten
Anti-BOLA1
Anti-BOLA1

Artikelnummer: G-PACO08034.50

BOLA1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB, IHC applications. BOLA1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that...
Schlagworte: Anti-hBolA, Anti-BolA-like protein 1
Anwendung: ELISA, WB, IHC
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
491,00 €
Bewerten
Anti-BOLA1
Anti-BOLA1

Artikelnummer: G-PACO25276.50

BOLA1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA applications. BOLA1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S)...
Schlagworte: Anti-hBolA, Anti-BolA-like protein 1
Anwendung: ELISA
Wirt: Rabbit
Spezies-Reaktivität: human
363,00 €
Bewerten
BOLA1 PrEST Antigen
BOLA1 PrEST Antigen

Artikelnummer: ATA-APrEST70989.100

Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with the monothiol glutaredoxin GLRX5 (PubMed:27532772). May protect cells against oxidative stress (PubMed:22746225). [The...
Schlagworte: hBolA, BolA-like protein 1
Anwendung: Control antigen
Exprimiert in: E.coli
Ursprungsart: human
247,00 €
Bewerten
BOLA1, Recombinant, Human, aa1-137, His-Tag (BolA-like Protein 1)
BOLA1, Recombinant, Human, aa1-137, His-Tag (BolA-like...

Artikelnummer: 372469.100

Source:, Recombinant protein corresponding to aa1-137 from human BOLA1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~16.3kD, AA Sequence: MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP, Storage and...
Schlagworte: hBolA, BolA-like protein 1
MW: 16,3
ab 531,00 €
Bewerten
Recombinant Human BOLA1 Protein (His Tag) (RPES4244)
Recombinant Human BOLA1 Protein (His Tag) (RPES4244)

Artikelnummer: G-RPES4244.20

Human BOLA1 Recombinant Protein (RPES4244) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably...
Schlagworte: hBolA, BolA-like protein 1
Exprimiert in: E.coli
Ursprungsart: human
1.165,00 €
Bewerten
Recombinant Human BOLA1 Protein (His tag)
Recombinant Human BOLA1 Protein (His tag)

Artikelnummer: E-PKSH030568.100

Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with the monothiol glutaredoxin GLRX5 (PubMed:27532772). May protect cells against oxidative stress (PubMed:22746225). [The...
Ursprungsart: human
1.016,00 €
Bewerten