• Bitte beachten Sie, dass wir wegen der Feiertage zwischen dem 19.12.2019 und dem 03.01.2020 keine Ware ausliefern. Bestellungen für Lieferungen in 2020 aber nehmen wir gern auch in diesem Zeitraum entgegen.

Sonstige Peptide

1 von 482 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
GHRP-6 (acetate)
GHRP-6 (acetate)

Artikelnummer: Cay27262-50

GHRP-6 is a synthetic growth hormone (GH) secretagogue and an agonist of the GH secretagogue receptor (GHS-R), which is also known as the ghrelin receptor. It inhibits binding of the GHS-R agonist MK-0677 (ibutamoren, Cay-18003) to COS-7 cell membranes expressing human GHS-R type Ia (Ki = 1.9 nM) and binding of...
Schlagworte: Hexapeptide-2, Growth hormone releasing peptide 6, HWAWFK-NH2, SKF 110679, U 75799E,...
Anwendung: Synthetic growth hormone, GH secretagogue receptor agonist
CAS 145177-42-0
MW: 10532 D
ab 82,00 €
Bewerten
Adrenomedullin (1-52) (porcine) (trifluoroacetate salt)
Adrenomedullin (1-52) (porcine) (trifluoroacetate salt)

Artikelnummer: Cay27406-1

Adrenomedullin (1-52) is a peptide that corresponds to amino acids 1-52 of the porcine adrenomedullin sequence and contains a disulfide bond between cysteine residues at positions 16 and 21. It contains a glycine at position 40 instead of an asparagine residue as in the human adrenomedullin (1-52) (Cay-24889)...
Schlagworte: YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDGVAPRSKISPQGY-NH2 (Cys16 and 21 bridge), adrenomedullin (porcine), trifluoroacetate...
MW: 59718 D
312,00 €
Bewerten
Glp-Amyloid-beta (3-40) Peptide (human) (trifluoroacetate salt)
Glp-Amyloid-beta (3-40) Peptide (human) (trifluoroacetate...

Artikelnummer: Cay27416-100

Glp-Amyloid-beta (3-40) peptide is a fragment of amyloid-beta (1-40) (Abeta40, Cay-21617) that contains the cyclic amino acid pyroglutamate at the N-terminus. Glp-Amyloid-beta (3-40) peptide is a major component of the endogenous amyloid-beta content in post-mortem brain tissue from patients with Alzheimer's...
Schlagworte: AbetapE3-40, AbetaN3(pE)-40, Glp-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV,...
MW: 41257 D
844,00 €
Bewerten
Selank (acetate)
Selank (acetate)

Artikelnummer: Cay27720-5

Selank is a synthetic derivative of the tetrapeptide tuftsin that contains a proline-glycine-proline sequence at the C-terminus and has anxiolytic and anti-inflammatory activities. It increases the amplitude and discharge rate of inhibitory postsynaptic currents of neurons in the rat hippocampal CA1 region when used...
Schlagworte: L-threonyl-L-lysyl-L-prolyl-L-arginyl-L-prolylglycyl-L-proline, monoacetate
Anwendung: Nootropic, Anxiolytic peptide
MW: 8119 D
ab 157,00 €
Bewerten
Gastrin Releasing Peptide, human
Gastrin Releasing Peptide, human

Artikelnummer: LKT-G0181.1

Endogenous bombesin-like peptide, involved in feeding behavior, stress signaling, circadian rhythms, GRP agonist.
Schlagworte: GRP
Anwendung: Metabolic studies
CAS 93755-85-2
MW: 2859,4 D
ab 224,00 €
Bewerten
Nociceptin
Nociceptin

Artikelnummer: LKT-N5210.5

Endogenous neuropeptide, involved in opioid signaling, NOP agonist.
Schlagworte: Orphanin FQ
Anwendung: Metabolic studies
CAS 170713-75-4
MW: 1809.1 D
ab 218,00 €
Bewerten
Ovalbumin Fragment (257-264)
Ovalbumin Fragment (257-264)

Artikelnummer: LKT-O8500.2

OVA antigen.
Anwendung: Antigenic peptide, Th1 immune response stimulation
MW: 963.2 D
ab 274,00 €
Bewerten
Peptide T
Peptide T

Artikelnummer: LKT-P1760.5

Peptide fragment of HIV-1 gp120.
Schlagworte: N-(N-(N2-(N-(N-(N-(N-L-alanyl-L- seryl)-L-thronyl)-L-threonyl)-L-threonyl)-L-asparaginyl)-L-tyrosyl)-L-Threonine
Anwendung: HIV cell entry inhibitor
CAS 106362-32-7
MW: 857.86 D
ab 143,00 €
Bewerten
L-Leucyl-L-Leucine methyl ester (hydrochloride)
L-Leucyl-L-Leucine methyl ester (hydrochloride)

Artikelnummer: Cay16008-1

L-Leucyl-L-Leucine methyl ester (LLME) is a lysosomal condensation product that has been reported to be cytotoxic towards natural killer cells and CD4+ and CD8+ T lymphocytes without affecting helper T cells and B cells. It has also been shown to induce death of monocytes, polymorphonuclear leukocytes, and myeloid...
Schlagworte: LLME, LLOMe, L-leucyl-L-leucine, methyl ester, monohydrochloride
Anwendung: Specific cytotoxin
CAS 6491-83-4
MW: 294.8 D
ab 32,00 €
Bewerten
PAR2 (1-6) (mouse, rat)
PAR2 (1-6) (mouse, rat)

Artikelnummer: Cay27125-5

PAR2 (1-6) is a synthetic peptide agonist of proteinase-activated receptor 2 (PAR2) that corresponds to residues 1-6 of the amino terminal tethered ligand sequence of mouse and rat PAR2. It also corresponds to residues 39-44 and 37-42 of the mouse and rat full-length sequences, respectively. PAR2 (1-6) induces...
Schlagworte: SLIGRL, L-seryl-L-leucyl-L-isoleucylglycyl-L-arginyl-L-leucine
Anwendung: Synthetic peptide PAR2 agonist
CAS 164081-25-8
MW: 657.8 D
ab 44,00 €
Bewerten
PAR4 (1-6) (human)
PAR4 (1-6) (human)

Artikelnummer: Cay27126-50

PAR4 (1-6) is a peptide agonist of proteinase-activated receptor 4 (PAR4) that corresponds to residues 1-6 of the amino terminal tethered ligand sequence of human PAR4 and residues 48-53 of the full-length sequence. It activates PAR4 and the cleavage site mutant PAR4R47A when used at a concentration of 500 µM. PAR4...
Schlagworte: GYPGQV, glycyl-L-tyrosyl-L-prolylglycyl-L-glutaminyl-L-valine
Anwendung: Synthetic peptide PAR4 agonist
CAS 225779-44-2
MW: 619.7 D
ab 162,00 €
Bewerten
PAR3 (1-6) (human)
PAR3 (1-6) (human)

Artikelnummer: Cay27129-500

PAR3 (1-6) is a synthetic peptide agonist of proteinase-activated receptor 1 (PAR1) that corresponds to residues 1-6 of the amino terminal tethered ligand sequence of human PAR3 and residues 39-44 of the full-length human sequence. PAR3 (1-6) activates p42/44 MAPK signaling in fibroblasts expressing PAR1, but not...
Schlagworte: TFRGAP, L-threonyl-L-phenylalanyl-L-arginylglycyl-L-alanyl-L-proline
Anwendung: Synthetic peptide PAR1 agonist
CAS 320347-28-2
MW: 647.7 D
ab 69,00 €
Bewerten
1 von 482 Seiten
Zuletzt angesehen