Für die Filterung wurden keine Ergebnisse gefunden!
EP3 Receptor Blocking Peptide
Artikelnummer: Cay301760-1
To be used in conjunction with Cayman's EP3 Receptor Polyclonal Antibody (Cay-101760) to block protein-antibody complex formation during immunochemical analysis for the EP3 receptor.Synonyms: PGE2 Receptor 1, Prostaglandin E2 Receptor 3. Amino Acids: Human EP3 receptor sequence amino acids 308-327...
| Schlagworte: | PGE2 Receptor 1, Prostaglandin E2 Receptor 3 |
| Anwendung: | ICC, WB |
177,00 €
CysLT2 Receptor (C-Term) Blocking Peptide
Artikelnummer: Cay320550-1
To be used in conjunction with Cayman's CysLT2 Receptor (C-Term) Polyclonal Antibody (Catalog No. 120550) to block protein-antibody complex formation during analysis for CysLT2 Receptor (C-Term) · The cysteinyl leukotrienes (cysLTs, LTC4, LTD4, and LTE4) contract airway and pulmonary vascular smooth muscle, increase...
| Schlagworte: | Cysteinyl Leukotriene Receptor 2 |
| Anwendung: | ELISA, FC, IHC, WB |
177,00 €
PAF Receptor Blocking Peptide (Monoclonal)
Artikelnummer: Cay360600-1
Each vial contains 200 µg of lyophilized peptide derived from the human PAF receptor sequence (amino acids 260-269: LGFQDSKFHQ). This peptide was used as an antigen for production of the PAF receptor monoclonal antibody (Catalog No. 160600). This blocking peptide can be used in conjunction with Cayman's PAF receptor...
| Schlagworte: | Platelet-activating Factor |
| Anwendung: | ELISA, FC, ICC |
177,00 €
Prostaglandin I Synthase Blocking Peptide
Artikelnummer: Cay360640-200
To be used in conjunction with Cayman's PGIS polyclonal antibody (Cay-160640) to block protein-antibody complex formation during immunochemical analysis for PGIS.Synonyms: PGIS, PGI Synthase, Prostacyclin Synthase. Amino Acids: Bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT). Formulation: (Request...
| Schlagworte: | PGI Synthase, PGIS, Prostacyclin Synthase |
| Anwendung: | IP, WB |
177,00 €
Caspase-3 (human) Blocking Peptide
Artikelnummer: Cay360745-200
This peptide was used as an antigen for production of Cayman's Caspase-3 (human) Polyclonal Antibody (Cay-160745) and can be used in conjunction with this antibody to block protein antibody complex formation during immunochemical analysis for caspase-3.Synonyms: Apopain, CPP32, ICE3, Yama. Amino Acids: Human...
| Schlagworte: | Apopain, CPP32, ICE3, Yama |
| Anwendung: | IHC, WB |
177,00 €
Control peptide for Notch 1 (intra) (Human specific)
Artikelnummer: 000-000-405
| Anwendung: | Control |
190,00 €
VASP-pSer157 blocking peptide
Artikelnummer: 2001-100
control phosphopeptide for nanoTools VASP (pSer 157) antibody - cat# 0085
| Anwendung: | Control |
218,00 €
BAFF, CT, Blocking Peptide (B cell Activating Factor...
Artikelnummer: B0003-65P.50
Members in the TNF superfamily regulate immune responses and induce apoptosis. A novel member in the TNF family was recently identified by several groups and designated BAFF (for B cell Activating Factor belonging to the TNF Family), BLyS (for B Lymphocyte Stimulator), TALL-1 (for TNF-and ApoL-related...
| Schlagworte: | CD257, TNFSF13B, B lymphocyte stimulator, B-cell-activating factor, Dendritic cell-derived TNF-like molecule, TNF- and... |
386,00 €
SIRP, alpha1, aa487-503, Blocking Peptide (SIRPa, Signal...
Artikelnummer: S1013-87A.50
Control peptide for S1013-87. Protein tyrosine phosphatases (PTPases) SHP-1 and SHP-2 are critical regulators in the intracellular signaling pathways that result in cell responses such as mitosis, differentiation, migration, survival, transformation or death. SHP-2 is a signal transducer for several receptor...
386,00 €
BLT1 Receptor Blocking Peptide
Artikelnummer: Cay120112-1
To be used in conjunction with Cayman's BLT1 Receptor Polyclonal Antibodies (Cay-100019, Cay-120114) to block protein-antibody complex formation during immunochemical analysis for the BLT1 receptor.Synonyms: BLTR1, LTB4 Receptor 1, Leukotriene B4 Receptor 1. Amino Acids: Human amino acids 331-352...
| Schlagworte: | BLTR1, Leukotriene B4 Receptor 1, LTB4 Receptor 1 |
| Anwendung: | FC, ICC, IHC, WB |
177,00 €
11beta-Hydroxysteroid Dehydrogenase (Type 1) Blocking...
Artikelnummer: Cay10005729-1
To be used in conjunction with Cayman's 11beta-HSD1 Polyclonal Antibody (Cay-10004303) to block protein-antibody complex formation during immunochemical analysis of 11beta-HSD1.Synonyms: 11beta-HSD1, Corticosteroid 11beta-Dehydrogenase Isozyme 1. Amino Acids: Human 11beta-HSD1 amino acids 78-92 (CLELGAASAHYLAGT)....
| Schlagworte: | 11beta-HSD1, Corticosteroid 11beta-Dehydrogenase Isozyme 1 |
| Anwendung: | IHC, WB |
177,00 €
PPARdelta Blocking Peptide
Artikelnummer: Cay10006247-1
To be used in conjunction with Cayman's PPARdelta Polyclonal Antibody (Cay-101720) to block protein-antibody complex formation during immunochemical analysis of PPARdelta.Synonyms: NR1C2, Peroxisome Proliferator-activated Receptor delta, PPARbeta. Amino Acids: Human PPARdelta amino acids 39-54. Formulation: (Request...
| Schlagworte: | NR1C2, Peroxisome Proliferator-activated Receptor delta, PPARbeta |
| Anwendung: | ICC, IHC, WB |
177,00 €