Anti-ZP2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59230.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: The mammalian zona pellucida, which mediates species- specific sperm binding,... mehr
Produktinformationen "Anti-ZP2"
Protein function: The mammalian zona pellucida, which mediates species- specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP2 may act as a secondary sperm receptor. [The UniProt Consortium]
Schlagworte: Anti-ZPA, Anti-ZP2
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59230

Eigenschaften

Anwendung: IHC (frozen), IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat)
Immunogen: Synthetic peptide corresponding to aa. 511-544 of Human ZP2. (ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD)
MW: 82 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ZP2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen