Anti-ZEB1

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ5497 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Zinc finger E-box-binding homeobox 1 is a... mehr
Produktinformationen "Anti-ZEB1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Zinc finger E-box-binding homeobox 1 is a protein that in humans is encoded by the ZEB1 gene. It is mapped to 10p11.22. This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described. Protein function: Acts as a transcriptional repressor. Inhibits interleukin-2 (IL-2) gene expression. Enhances or represses the promoter activity of the ATP1A1 gene depending on the quantity of cDNA and on the cell type. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. Represses RCOR1 transcription activation during neurogenesis. Represses transcription by binding to the E box (5'-CANNTG-3'). In the absence of TGFB1, acts as a repressor of COL1A2 transcription via binding to the E-box in the upstream enhancer region. [The UniProt Consortium]
Schlagworte: Anti-TCF-8, Anti-Transcription factor 8, Anti-Negative regulator of IL2, Anti-NIL-2-A zinc finger protein, Anti-Zinc finger E-box-binding homeobox 1, ZEB1 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ5497

Eigenschaften

Anwendung: WB, IHC (paraffin), IF, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-ZEB1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen