Anti-Villin

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31923 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Villin is known as VIL1. This gene encodes... mehr
Produktinformationen "Anti-Villin"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Villin is known as VIL1. This gene encodes a member of a family of calcium-regulated actin-binding proteins. This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, severing, and bundling of actin filaments. Two mRNAs of 2.7 kb and 3.5 kb have been observed, they result from utilization of alternate poly-adenylation signals present in the terminal exon. In vertebrates, the villin proteins help to support the microfilaments of the microvilli of the brush border. It may play a role in cell plasticity through F-actin severing. Protein function: Epithelial cell-specific Ca(2+)-regulated actin- modifying protein that modulates the reorganization of microvillar actin filaments. Plays a role in the actin nucleation, actin filament bundle assembly, actin filament capping and severing. Binds phosphatidylinositol 4,5-bisphosphate (PIP2) and lysophosphatidic acid (LPA), binds LPA with higher affinity than PIP2. Binding to LPA increases its phosphorylation by SRC and inhibits all actin-modifying activities. Binding to PIP2 inhibits actin-capping and -severing activities but enhances actin-bundling activity. Regulates the intestinal epithelial cell morphology, cell invasion, cell migration and apoptosis. Protects against apoptosis induced by dextran sodium sulfate (DSS) in the gastrointestinal epithelium. Appears to regulate cell death by maintaining mitochondrial integrity. Enhances hepatocyte growth factor (HGF)-induced epithelial cell motility, chemotaxis and wound repair. Upon S.flexneri cell infection, its actin-severing activity enhances actin-based motility of the bacteria and plays a role during the dissemination. [The UniProt Consortium]
Schlagworte: Anti-VIL, Anti-VIL1, Anti-Villin-1, Villin Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31923

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids EQLVNKPVEELPEGVDPSRKEEHLSIEDFT of human Villin were used as the immunogen for the Villin antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Villin"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen