Anti-UPF3B / RENT3B

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32318 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Regulator of nonsense transcripts 3B is a... mehr
Produktinformationen "Anti-UPF3B / RENT3B"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Regulator of nonsense transcripts 3B is a protein that in humans is encoded by the UPF3B gene. This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The encoded protein is one of two functional homologs to yeast Upf3p. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions. This gene is located on the long arm of chromosome X. Two splice variants encoding different isoforms have been found for this gene. Protein function: Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by associating with the nuclear exon junction complex (EJC) and serving as link between the EJC core and NMD machinery. Recruits UPF2 at the cytoplasmic side of the nuclear envelope and the subsequent formation of an UPF1-UPF2- UPF3 surveillance complex (including UPF1 bound to release factors at the stalled ribosome) is believed to activate NMD. In cooperation with UPF2 stimulates both ATPase and RNA helicase activities of UPF1. Binds spliced mRNA upstream of exon-exon junctions. In vitro, stimulates translation, the function is independent of association with UPF2 and components of the EJC core. [The UniProt Consortium]
Schlagworte: Anti-UPF3B, Anti-RENT3B, Anti-hUpf3B, Anti-hUpf3p-X, Anti-Nonsense mRNA reducing factor 3B, Anti-Regulator of nonsense transcripts 3B, Anti-Up-frameshift suppressor 3 homolog B, Anti-Up-frameshift suppressor 3 homolog on chromosome X, UPF3B / RENT3B Antib
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32318

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL of human UPF3B were used as the immunogen for the UPF3B antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-UPF3B / RENT3B"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen