Anti-UPF3B

Anti-UPF3B
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG43088.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop... mehr
Produktinformationen "Anti-UPF3B"
Protein function: Involved in nonsense-mediated decay (NMD) of mRNAs containing premature stop codons by associating with the nuclear exon junction complex (EJC) and serving as link between the EJC core and NMD machinery. Recruits UPF2 at the cytoplasmic side of the nuclear envelope and the subsequent formation of an UPF1-UPF2-UPF3 surveillance complex (including UPF1 bound to release factors at the stalled ribosome) is believed to activate NMD. In cooperation with UPF2 stimulates both ATPase and RNA helicase activities of UPF1. Binds spliced mRNA upstream of exon-exon junctions. In vitro, stimulates translation, the function is independent of association with UPF2 and components of the EJC core. [The UniProt Consortium]
Schlagworte: Anti-UPF3B, Anti-RENT3B, Anti-hUpf3B, Anti-hUpf3B, Anti-hUpf3p-X, Anti-hUpf3p-X, Anti-Nonsense mRNA reducing factor 3B, Anti-Nonsense mRNA reducing factor 3B, Anti-Regulator of nonsense transcripts 3B, Anti-Up-frameshift suppressor 3 homolog B, Anti-Regul
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG43088

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat (Erwartet: mouse, bovine)
Immunogen: Synthetic peptide corresponding to aa. 416-452 of Human UPF3B. (SEKTEKKEEVVKRDRIRNKDRPAMQLYQPGARSRNRL)
MW: 58 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-UPF3B"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen