Anti-TSG6

Anti-TSG6
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32752 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tumor necrosis factor-inducible gene 6... mehr
Produktinformationen "Anti-TSG6"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene. The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis. Protein function: Possibly involved in cell-cell and cell-matrix interactions during inflammation and tumorigenesis. [The UniProt Consortium]
Schlagworte: Anti-TSG6, Anti-TSG-6, Anti-TNFAIP6, Anti-TNF alpha-induced protein 6, Anti-Hyaluronate-binding protein, Anti-TNF-stimulated gene 6 protein, Anti-Tumor necrosis factor alpha-induced protein 6, Anti-Tumor necrosis factor-inducible gene 6 protein, TSG6 Anti
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32752

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Amino acids 46-91 (KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR) from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-TSG6"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen