Anti-TPP1

Anti-TPP1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31801 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tripeptidyl-peptidase 1, also known as... mehr
Produktinformationen "Anti-TPP1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tripeptidyl-peptidase 1, also known as Lysosomal pepstatin-insensitive protease, is an enzyme that in humans is encoded by the TPP1 gene. This gene encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome. Protein function: Lysosomal serine protease with tripeptidyl-peptidase I activity. May act as a non-specific lysosomal peptidase which generates tripeptides from the breakdown products produced by lysosomal proteinases. Requires substrates with an unsubstituted N-terminus. [The UniProt Consortium]
Schlagworte: Anti-LPIC, Anti-CLN2, Anti-TPP1, Anti-GIG1, Anti-TPP-1, Anti-TPP-I, EC=3.4.14.9, Anti-Tripeptidyl-peptidase I, Anti-Tripeptidyl-peptidase 1, Anti-Tripeptidyl aminopeptidase, Anti-Cell growth-inhibiting gene 1 protein, TPP1 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31801

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids CAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV of human TPP1 were used as the immunogen for the TPP1 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-TPP1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen