Anti-Thrombospondin 2 / THBS2

Anti-Thrombospondin 2 / THBS2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4469 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Thrombospondin-2 (THBS2) is a protein that... mehr
Produktinformationen "Anti-Thrombospondin 2 / THBS2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Thrombospondin-2 (THBS2) is a protein that in humans is encoded by the THBS2 gene. The protein encoded by this gene belongs to the thrombospondin family. The THBS2 is mapped to 6q27 and it is located on chromosome 17. The gene was transcribed in fibroblasts, smooth muscle cells, and an osteosarcoma cell line. It functions as a protein inhibitor of tumor growth and angiogenesis and modulates the cell surface properties of mesenchymal cells and be involved in cell adhesion and migration. Protein function: Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties. [The UniProt Consortium]
Schlagworte: Anti-TSP2, Anti-THBS2, Anti-Thrombospondin-2, Thrombospondin 2 Antibody / THBS2
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4469

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids DHVKDTSFDLFSISNINRKTIGAKQFRGPD
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Thrombospondin 2 / THBS2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen