Anti-TAP1

Anti-TAP1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59133.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Involved in the transport of antigens from the cytoplasm to the endoplasmic... mehr
Produktinformationen "Anti-TAP1"
Protein function: Involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. Also acts as a molecular scaffold for the final stage of MHC class I folding, namely the binding of peptide. Nascent MHC class I molecules associate with TAP via tapasin. Inhibited by the covalent attachment of herpes simplex virus ICP47 protein, which blocks the peptide-binding site of TAP. Inhibited by human cytomegalovirus US6 glycoprotein, which binds to the lumenal side of the TAP complex and inhibits peptide translocation by specifically blocking ATP-binding to TAP1 and prevents the conformational rearrangement of TAP induced by peptide binding. Inhibited by human adenovirus E3-19K glycoprotein, which binds the TAP complex and acts as a tapasin inhibitor, preventing MHC class I/TAP association. Expression of TAP1 is down-regulated by human Epstein-Barr virus vIL-10 protein, thereby affecting the transport of peptides into the endoplasmic reticulum and subsequent peptide loading by MHC class I molecules. [The UniProt Consortium]
Schlagworte: Anti-APT1, Anti-ABCB2, Anti-PSF-1, Anti-Peptide supply factor 1, Anti-Peptide transporter PSF1, Anti-Peptide transporter TAP1, Anti-Antigen peptide transporter 1, Anti-Really interesting new gene 4 protein, Anti-ATP-binding cassette sub-family B member 2
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59133

Eigenschaften

Anwendung: IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Synthetic peptide corresponding to aa. 438-471 of Human TAP1. (RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN)
MW: 87 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-TAP1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen