Anti-STIP1

Anti-STIP1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32069 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. STIP1 is an adaptor protein that... mehr
Produktinformationen "Anti-STIP1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. STIP1 is an adaptor protein that coordinates the functions of HSP70 and HSP90 in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones. The International Radiation Hybrid Mapping Consortium mapped the STIP1 gene to 11q13. Protein function: Mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB). [The UniProt Consortium]
Schlagworte: Anti-Hop, Anti-STI1, Anti-STIP1, Anti-Hsc70/Hsp90-organizing protein, Anti-Stress-induced-phosphoprotein 1, Anti-Renal carcinoma antigen NY-REN-11, Anti-Transformation-sensitive protein IEF SSP 3521, STIP1 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32069

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Amino acids RLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR of human STIP1 were used as the immunogen for the STIP1 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-STIP1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen