Anti-SMC1B (Structural Maintenance of Chromosomes Protein 1B, SMC Protein 1B, SMC-1-beta, SMC-1B, SM

Anti-SMC1B (Structural Maintenance of Chromosomes Protein 1B, SMC Protein 1B, SMC-1-beta, SMC-1B, SM
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
133564.100 100 µg - -

3 - 19 Werktage*

699,00 €
 
Applications:|Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications... mehr
Produktinformationen "Anti-SMC1B (Structural Maintenance of Chromosomes Protein 1B, SMC Protein 1B, SMC-1-beta, SMC-1B, SM"
Applications:, Suitable for use in ELISA, Western Blot and Immunofluorescence. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: KVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELKGCKMVIDVIKTQFPQLKKVIQFVCGNGLVCETMEEARHIALSGPERQKTVALDGTLFLKSGVISGGSSDLK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 133564

Eigenschaften

Anwendung: ELISA, IF, WB
Antikörper-Typ: Monoclonal
Klon: 6A10
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Format: Affinity Purified

Datenbank Information

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SMC1B (Structural Maintenance of Chromosomes Protein 1B, SMC Protein 1B, SMC-1-beta, SMC-1B, SM"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen