Anti-SMAD (SMAD1-5)

Anti-SMAD (SMAD1-5)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32238 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SMADs are proteins that modulate the... mehr
Produktinformationen "Anti-SMAD (SMAD1-5)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SMADs are proteins that modulate the activity of transforming growth factor beta ligands. The SMADs, often in complex with other SMADs/CoSMAD, act as transcription factors that regulate the expression of certain genes. It was concluded that targeted ubiquitination of SMADs may serve to control both embryonic development and a wide variety of cellular responses to TGF-beta signals. R-Smads or receptor regulated Smads are a class of proteins that include SMAD1, SMAD2, SMAD3, SMAD5, and SMAD8. In response to signals by the TGF-beta superfamily of ligands these proteins associate with receptor kinases and are phosphorylated at an SSXS motif at their extreme C-terminus. These proteins then typically bind to the common mediator Smad or co-SMAD SMAD4. Protein function: Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD1 is a receptor-regulated SMAD (R-SMAD). SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1. May act synergistically with SMAD4 and YY1 in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression. [The UniProt Consortium]
Schlagworte: Anti-BSP1, Anti-SMAD1, Anti-JV4-1, Anti-Smad1, Anti-BSP-1, Anti-hSMAD1, Anti-SMAD 1, Anti-MAD homolog 1, Anti-SMAD family member 1, Anti-Mad-related protein 1, Anti-Mothers against DPP homolog 1, Anti-Mothers against decapentaplegic homolog 1, SMAD Antibo
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32238

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids QPMDTNMMAPPLPSEINRGDVQAVAYEEPKH of human SMAD1-5 were used as the immunogen for the SMAD antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SMAD (SMAD1-5)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen