Anti-SLC15A2 / PepT2

Anti-SLC15A2 / PepT2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG41690.50 50 µl - -

6 - 14 Werktage*

520,00 €
 
Protein function: Proton-coupled intake of oligopeptides of 2 to 4 amino acids with a preference... mehr
Produktinformationen "Anti-SLC15A2 / PepT2"
Protein function: Proton-coupled intake of oligopeptides of 2 to 4 amino acids with a preference for dipeptides (PubMed:7756356). Transports the dipeptide-like aminopeptidase inhibitor bestatin. Can also transport the aminocephalosporin antibiotic cefadroxil. [The UniProt Consortium]
Schlagworte: Anti-PEPT2, Anti-SLC15A2, Anti-Peptide transporter 2, Anti-Kidney H(+)/peptide cotransporter, Anti-Solute carrier family 15 member 2, Anti-Oligopeptide transporter, kidney isoform
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG41690

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, cow, dog, guinea pig, horse, swine, rabbit)
Immunogen: Synthetic peptide around the middle region of Human SLC15A2 / PepT2. (within the following region: GNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSV)
MW: 82 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SLC15A2 / PepT2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen