Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
---|---|---|---|---|---|---|---|
NSJ-RQ4213 | 100 µg | - | - |
3 - 10 Werktage* |
755,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Pulmonary surfactant-associated protein B... mehr
Produktinformationen "Anti-SFTPB / Pulmonary surfactant-associated protein B"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Pulmonary surfactant-associated protein B is a protein that in humans is encoded by the SFTPB gene. This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified. Protein function: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air- liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. [The UniProt Consortium]
Schlagworte: | Anti-SP-B, Anti-SFTP3, Anti-SFTPB, Anti-6 kDa protein, Anti-18 kDa pulmonary-surfactant protein, Anti-Pulmonary surfactant-associated protein B, Anti-Pulmonary surfactant-associated proteolipid SPL(Phe), SFTPB Antibody / Pulmonary surfactant-associated pr |
Hersteller: | NSJ Bioreagents |
Hersteller-Nr: | RQ4213 |
Eigenschaften
Anwendung: | WB |
Antikörper-Typ: | Polyclonal |
Konjugat: | No |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
Immunogen: | Amino acids QCLAERYSVILLDTLLGRMLPQLVCRLVLR were used as the immunogen for the SFTPB antibody. |
Format: | Purified |
Datenbank Information
UniProt ID : | P07988 | Passende Produkte |
Gene ID | GeneID 6439 | Passende Produkte |
Handhabung & Sicherheit
Lagerung: | +4°C |
Versand: | +4°C (International: +4°C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SFTPB / Pulmonary surfactant-associated protein B"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen