Anti-SFTPB / Pulmonary surfactant-associated protein B

Anti-SFTPB / Pulmonary surfactant-associated protein B
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4213 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Pulmonary surfactant-associated protein B... mehr
Produktinformationen "Anti-SFTPB / Pulmonary surfactant-associated protein B"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Pulmonary surfactant-associated protein B is a protein that in humans is encoded by the SFTPB gene. This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified. Protein function: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air- liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter. [The UniProt Consortium]
Schlagworte: Anti-SP-B, Anti-SFTP3, Anti-SFTPB, Anti-6 kDa protein, Anti-18 kDa pulmonary-surfactant protein, Anti-Pulmonary surfactant-associated protein B, Anti-Pulmonary surfactant-associated proteolipid SPL(Phe), SFTPB Antibody / Pulmonary surfactant-associated pr
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4213

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids QCLAERYSVILLDTLLGRMLPQLVCRLVLR were used as the immunogen for the SFTPB antibody.
Format: Purified

Datenbank Information

UniProt ID : P07988 | Passende Produkte
Gene ID GeneID 6439 | Passende Produkte

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SFTPB / Pulmonary surfactant-associated protein B"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen