Anti-SFTPA1/2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32279 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SFTPA1/2 is also known as SP-A. SFTPA1... mehr
Produktinformationen "Anti-SFTPA1/2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SFTPA1/2 is also known as SP-A. SFTPA1 encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential role in surfactant homeostasis and in the defense against respiratory pathogens. Mutations in this gene are associated with idiopathic pulmonary fibrosis. Alternate splicing results in multiple transcript variants. SFTPA2 is one of several genes encoding pulmonary-surfactant associated proteins (SFTPA) located on chromosome 10. Mutations in this gene and a highly similar gene located nearby, which affect the highly conserved carbohydrate recognition domain, are associated with idiopathic pulmonary fibrosis. The current version of the assembly displays only a single centromeric SFTPA gene pair rather than the two gene pairs shown in the previous assembly which were thought to have resulted from a duplication. Protein function: In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air- liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. [The UniProt Consortium]
Schlagworte: Anti-PSPA, Anti-SP-A, Anti-SP-A2, Anti-PSP-A, Anti-SFTPA2, Anti-COLEC5, Anti-Collectin-5, Anti-Alveolar proteinosis protein, Anti-Pulmonary surfactant-associated protein A2, Anti-35 kDa pulmonary surfactant-associated protein, SFTPA1/2 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32279

Eigenschaften

Anwendung: WB, IHC (paraffin), (IF), IF
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN of human SFTPA1/2
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-SFTPA1/2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen