Anti-RXFP2 / Relaxin Receptor 2

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4608 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Relaxin/insulin-like family peptide... mehr
Produktinformationen "Anti-RXFP2 / Relaxin Receptor 2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Relaxin/insulin-like family peptide receptor 2, also known as RXFP2, is a human G-protein coupled receptor. It is mapped to 13q13.1. This gene encodes a member of the GPCR (G protein-coupled, 7-transmembrane receptor) family. Mutations in this gene are associated with cryptorchidism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. Protein function: Receptor for relaxin. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. May also be a receptor for Leydig insulin-like peptide (INSL3). [The UniProt Consortium]
Schlagworte: Anti-RXFP2, Anti-GPR106, Anti-Relaxin receptor 2, Anti-G-protein coupled receptor 106, Anti-Relaxin family peptide receptor 2, Anti-G-protein coupled receptor affecting testicular descent, Anti-Leucine-rich repeat-containing G-protein coupled receptor 8,
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4608

Eigenschaften

Anwendung: WB, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-RXFP2 / Relaxin Receptor 2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen