Anti-RAB6A

Anti-RAB6A
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59020.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Protein transport. Regulator of membrane traffic from the Golgi apparatus... mehr
Produktinformationen "Anti-RAB6A"
Protein function: Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER). Has a low GTPase activity. Involved in COPI-independent retrograde transport from the Golgi to the ER (PubMed:25962623). [The UniProt Consortium]
Schlagworte: Anti-RAB6, Anti-Rab-6, Anti-RAB6A, Anti-Ras-related protein Rab-6A
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59020

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human RAB6A (RRVAAALPGMESTQDRSREDMIDIKLEKPQEQPVSE)
MW: 23 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-RAB6A"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen