Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
---|---|---|---|---|---|---|---|
250588.50 | 50 µl | - | - |
3 - 19 Werktage* |
699,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure... mehr
Produktinformationen "Anti-PSMD10 (Proteasome (Prosome, Macropain) 26S Subunit, non-ATPase, 10, dJ889N15.2, p28)"
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator. Two transcripts encoding different isoforms have been described. Pseudogenes have been identified on chromosomes 3 and 20. [provided by RefSeq, Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRMouse polyclonal antibody raised against a full-length human PSMD10 protein.KGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: | United States Biological |
Hersteller-Nr: | 250588 |
Eigenschaften
Anwendung: | IF, WB |
Antikörper-Typ: | Polyclonal |
Konjugat: | No |
Wirt: | Mouse |
Spezies-Reaktivität: | human |
Immunogen: | PSMD10 (NP_002805, 1aa-226aa) full-length human protein. |
Format: | Purified |
Datenbank Information
Handhabung & Sicherheit
Lagerung: | -20°C |
Versand: | +4°C (International: °C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-PSMD10 (Proteasome (Prosome, Macropain) 26S Subunit, non-ATPase, 10, dJ889N15.2, p28)"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
Zuletzt angesehen