Anti-Prolactin Receptor / PRLR

Anti-Prolactin Receptor / PRLR
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31984 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PRLR (Prolactin Receptor) is a cytokine... mehr
Produktinformationen "Anti-Prolactin Receptor / PRLR"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PRLR (Prolactin Receptor) is a cytokine receptor. By somatic cell hybrid analysis and by in situ hybridization, Arden et al. (1989, 1990) demonstrated that the prolactin receptor gene resides in the same chromosomal region as the growth hormone receptor gene, which has been mapped to 5p13-p12. Cunningham et al. (1990) demonstrated that zinc greatly increases the affinity of GH for the extracellular binding domain of PRLR, although it is not required for binding of GH to the growth hormone receptor or for binding of prolactin to the prolactin receptor. By mutational analysis, they showed that a cluster of 3 residues (histidine-18, histidine-21, and glutamic acid-174) in GH and histidine-188 in PRLR (conserved in all PRL receptors but not GH receptors) are likely zinc-ion ligands. Protein function: This is a receptor for the anterior pituitary hormone prolactin (PRL). Acts as a prosurvival factor for spermatozoa by inhibiting sperm capacitation through suppression of SRC kinase activation and stimulation of AKT. Isoform 4 is unable to transduce prolactin signaling. Isoform 6 is unable to transduce prolactin signaling. [The UniProt Consortium]
Schlagworte: Anti-PRLR, Anti-PRL-R, Anti-Prolactin receptor, Prolactin Receptor Antibody / PRLR
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31984

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids HAKNVACFEESAKEAPPSLEQNQAEKALANFTATSSKCRLQ of human PRLR were used as the immunogen for the PRLR antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Prolactin Receptor / PRLR"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen