Anti-PKLR

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32061 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Pyruvate kinase isozymes R/L is an enzyme... mehr
Produktinformationen "Anti-PKLR"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Pyruvate kinase isozymes R/L is an enzyme that in humans is encoded by the PKLR gene. It is mapped to 1q21. The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene. Protein function: Pyruvate kinase that catalyzes the conversion of phosphoenolpyruvate to pyruvate with the synthesis of ATP, and which plays a key role in glycolysis. [The UniProt Consortium]
Schlagworte: Anti-PK1, Anti-PKLR, Anti-Pyruvate kinase 1, Anti-Pyruvate kinase PKLR, Anti-Pyruvate kinase isozymes L/R, Anti-R-type/L-type pyruvate kinase, Anti-Red cell/liver pyruvate kinase, PKLR Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32061

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids EAIWADDVDRRVQFGIESGKLRGFLRVGDLV of human PKLR
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-PKLR"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen