Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
---|---|---|---|---|---|---|---|
NSJ-R32107 | 100 µg | - | - |
3 - 10 Werktage* |
755,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Phospholipase A2, Group IVA, is an enzyme... mehr
Produktinformationen "Anti-Phospholipase A2 / PLA2G4A / CPLA2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Phospholipase A2, Group IVA, is an enzyme that in humans is encoded by the PLA2G4A gene. Tay et al. (1995) mapped the PLA2G4A gene to rat chromosome 13 by PCR-based intercross genotyping and to human 1q25 by fluorescence in situ hybridization. By site-directed mutagenesis and biochemical analysis of the recombinant protein, Sharp et al. (1994) determined that ser228 participates in the catalytic mechanism of cPLA2 and that both the phospholipase A2 and the lysophospholipase activities are catalyzed by the same active site residue(s). PLA2G4A, the cytosolic phospholipase A2, appears to subserve transmembrane signaling responses to extracellular ligands (Skorecki, 1995). Protein function: Selectively hydrolyzes arachidonyl phospholipids in the sn-2 position releasing arachidonic acid. Together with its lysophospholipid activity, it is implicated in the initiation of the inflammatory response. [The UniProt Consortium]
Schlagworte: | Anti-cPLA2, Anti-CPLA2, Anti-PLA2G4A, EC=3.1.1.5, EC=3.1.1.4, Anti-Phospholipase A2, Anti-Lysophospholipase, Anti-Cytosolic phospholipase A2, Anti-Phospholipase A2 group IVA, Anti-Phosphatidylcholine 2-acylhydrolase, Phospholipase A2 Antibody / PLA2G4A / |
Hersteller: | NSJ Bioreagents |
Hersteller-Nr: | R32107 |
Eigenschaften
Anwendung: | WB |
Antikörper-Typ: | Polyclonal |
Konjugat: | No |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
Immunogen: | Amino acids NFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRRQ of human PLA2G4A were used as the immunogen for the Phospholipase A2 antibody. |
Format: | Purified |
Datenbank Information
KEGG ID : | K16342 | Passende Produkte |
UniProt ID : | P47712 | Passende Produkte |
Gene ID | GeneID 5321 | Passende Produkte |
Handhabung & Sicherheit
Lagerung: | -20°C |
Versand: | -20°C (International: -20°C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Phospholipase A2 / PLA2G4A / CPLA2"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
-30 %
Rabattaktion
Zuletzt angesehen