| Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
|---|---|---|---|---|---|---|---|
| ARG59034.50 | 50 µg | - | - |
6 - 14 Werktage* |
520,00 €
|
| Schlagworte: | Anti-PRDX4, Anti-Prx-IV, Anti-AOE37-2, Anti-Peroxiredoxin-4, Anti-Peroxiredoxin IV, Anti-Antioxidant enzyme AOE372, Anti-Thioredoxin peroxidase AO372, Anti-Thioredoxin-dependent peroxide reductase A0372 |
| Hersteller: | Arigo Biolaboratories |
| Hersteller-Nr: | ARG59034 |
Eigenschaften
| Anwendung: | ICC, IHC (paraffin), WB |
| Antikörper-Typ: | Polyclonal |
| Konjugat: | No |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
| Immunogen: | Synthetic peptide corresponding to aa. 178-208 of Human Peroxiredoxin 4 (SDLTHQISKDYGVYLEDSGHTLRGLFIIDDK) |
| MW: | 31 kD |
| Format: | Antigen Affinity Purified |
Datenbank Information
| KEGG ID : | K03386 | Passende Produkte |
| UniProt ID : | Q13162 | Passende Produkte |
| Gene ID | GeneID 10549 | Passende Produkte |
Handhabung & Sicherheit
| Lagerung: | -20°C |
| Versand: | +4°C (International: °C) |
