Anti-NUSAP1 (Nucleolar and Spindle-associated Protein 1, NuSAP, ANKT, BM-037, PRO0310, BM037, FLJ134

Anti-NUSAP1 (Nucleolar and Spindle-associated Protein 1, NuSAP, ANKT, BM-037, PRO0310, BM037, FLJ134
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
130660.50 50 µg - -

3 - 19 Werktage*

699,00 €
 
Microtubule-associated protein with the capacity to bundle and stabilize microtubules By... mehr
Produktinformationen "Anti-NUSAP1 (Nucleolar and Spindle-associated Protein 1, NuSAP, ANKT, BM-037, PRO0310, BM037, FLJ134"
Microtubule-associated protein with the capacity to bundle and stabilize microtubules By similarity. May associate with chromosomes and promote the organization of mitotic spindle microtubules around them. Applications: Suitable for use in Immunofluorescence and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: MNELKQQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKTGVRFSAATKDNEHKRSLTKTPARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTPVSNKKPVFDLKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQERKEKKAKVLGMRRGLILAED, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 130660

Eigenschaften

Anwendung: IF, WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Format: Affinity Purified

Datenbank Information

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-NUSAP1 (Nucleolar and Spindle-associated Protein 1, NuSAP, ANKT, BM-037, PRO0310, BM037, FLJ134"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen