Anti-NPY / Neuropeptide Y

Anti-NPY / Neuropeptide Y
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31709 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Neuropeptide Y is widely expressed in the... mehr
Produktinformationen "Anti-NPY / Neuropeptide Y"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Neuropeptide Y is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function. The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels. A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases. Neuropeptide Y also exhibits antimicrobial activity against bacteria and fungi. Protein function: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. [The UniProt Consortium]
Schlagworte: Anti-NPY, NPY Antibody / Neuropeptide Y
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31709

Eigenschaften

Anwendung: IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acid sequence from the middle region of human Neuropeptide Y (YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY)
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-NPY / Neuropeptide Y"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen