Anti-NOXO1

Artikelnummer	Größe	Datenblatt	Manual	SDB	Lieferzeit	Menge	Preis
ARG41407.50	50 µl		-	-	6 - 14 Werktage*		520,00 €

Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage

Protein function: Constitutively potentiates the superoxide-generating activity of NOX1 and NOX3... mehr

Menü schließen

Produktinformationen "Anti-NOXO1"

Protein function: Constitutively potentiates the superoxide-generating activity of NOX1 and NOX3 and is required for the biogenesis of otoconia/otolith, which are crystalline structures of the inner ear involved in the perception of gravity. Isoform 3 is more potent than isoform 1 in activating NOX3. Together with NOXA1, may also substitute to NCF1/p47phox and NCF2/p67phox in supporting the phagocyte NOX2/gp91phox superoxide-generating activity. [The UniProt Consortium]

Schlagworte:	Anti-NOXO1, Anti-P41NOX, Anti-Nox organizer 1, Anti-Nox-organizing protein 1, Anti-NADPH oxidase organizer 1, Anti-NADPH oxidase regulatory protein, Anti-SH3 and PX domain-containing protein 5
Hersteller:	Arigo Biolaboratories
Hersteller-Nr:	ARG41407

Eigenschaften

Anwendung:	WB
Antikörper-Typ:	Polyclonal
Konjugat:	No
Wirt:	Rabbit
Spezies-Reaktivität:	human (Erwartet: cow, horse)
Immunogen:	Synthetic peptide derived from Human NOXO1. (within the following region: HSLEAQSLRCLQPFCTQDTRDRPFQAQAQESLDVLLRHPSGWWLVENEDR)
MW:	40 kD
Format:	Affinity Purified

Datenbank Information

KEGG ID :	K17934 \| Passende Produkte
UniProt ID :	Q8NFA2 \| Passende Produkte
Gene ID	GeneID 124056 \| Passende Produkte

Handhabung & Sicherheit

Lagerung:	-20°C
Versand:	+4°C (International: °C)

Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!

Hier folgen Informationen zur Produktreferenz. mehr

Menü schließen

View product citations for antibody ARG41407 on CiteAb

Hier kriegen Sie ein Zertifikat

Zurück

Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.

Bewertungen lesen, schreiben und diskutieren... mehr

Menü schließen

Kundenbewertungen für "Anti-NOXO1"

Bewertung schreiben

Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.