Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Artikelnummer | Größe | Datenblatt | Manual | SDB | Lieferzeit | Menge | Preis |
---|---|---|---|---|---|---|---|
NSJ-RQ4166 | 100 µg | - | - |
3 - 10 Werktage* |
755,00 €
|
Bei Fragen nutzen Sie gerne unser Kontaktformular.
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
Bestellen Sie auch per E-Mail: info@biomol.com
Größere Menge gewünscht? Bulk-Anfrage
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NADPH oxidase 4 is an enzyme that in... mehr
Produktinformationen "Anti-NOX4 / NADPH oxidase 4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. NADPH oxidase 4 is an enzyme that in humans is encoded by the NOX4 gene, and is a member of the NOX family of NADPH oxidases. This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants. Protein function: NADPH oxidase that catalyzes predominantly the reduction of oxygen to H2O2 (PubMed:15356101, PubMed:14966267, PubMed:15927447, PubMed:25062272, PubMed:21343298). Can also catalyze to a smaller extent, the reduction of oxygen to superoxide (PubMed:10869423, PubMed:11032835, PubMed:15155719, PubMed:15572675, PubMed:16230378, PubMed:16179589, PubMed:16324151, PubMed:15927447, PubMed:16019190, PubMed:25062272). May function as an oxygen sensor regulating the KCNK3/TASK-1 potassium channel and HIF1A activity (PubMed:16019190). May regulate insulin signaling cascade (PubMed:14966267). May play a role in apoptosis, bone resorption and lipolysaccharide-mediated activation of NFKB (PubMed:15572675, PubMed:15356101). May produce superoxide in the nucleus and play a role in regulating gene expression upon cell stimulation (PubMed:16324151). [The UniProt Consortium]
Schlagworte: | Anti-NOX4, Anti-RENOX, Anti-KOX-1, Anti-NADPH oxidase 4, Anti-Kidney oxidase-1, Anti-Renal NAD(P)H-oxidase, Anti-Kidney superoxide-producing NADPH oxidase, NOX4 Antibody / NADPH oxidase 4 |
Hersteller: | NSJ Bioreagents |
Hersteller-Nr: | RQ4166 |
Eigenschaften
Anwendung: | IF, WB |
Antikörper-Typ: | Polyclonal |
Konjugat: | No |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, monkey |
Immunogen: | Amino acids ILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLL |
Format: | Purified |
Datenbank Information
KEGG ID : | K21423 | Passende Produkte |
UniProt ID : | Q9NPH5 | Passende Produkte |
Gene ID | GeneID 50507 | Passende Produkte |
Handhabung & Sicherheit
Lagerung: | +4°C |
Versand: | +4°C (International: +4°C) |
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz.
mehr
Hier kriegen Sie ein Zertifikat
Loggen Sie sich ein oder registrieren Sie sich, um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-NOX4 / NADPH oxidase 4"
Bewertung schreiben
Loggen Sie sich ein oder registrieren Sie sich, um eine Produktbewertung abzugeben.
-30 %
Rabattaktion
Zuletzt angesehen