Anti-NONO / p54nrb

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40515.50 50 µl - -

6 - 14 Werktage*

520,00 €
 
Protein function: DNA- and RNA binding protein, involved in several nuclear processes. Binds the... mehr
Produktinformationen "Anti-NONO / p54nrb"
Protein function: DNA- and RNA binding protein, involved in several nuclear processes. Binds the conventional octamer sequence in double-stranded DNA. Also binds single-stranded DNA and RNA at a site independent of the duplex site. Involved in pre-mRNA splicing, probably as a heterodimer with SFPQ. Interacts with U5 snRNA, probably by binding to a purine-rich sequence located on the 3' side of U5 snRNA stem 1b. Together with PSPC1, required for the formation of nuclear paraspeckles. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs. The SFPQ-NONO heteromer may be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1. The SFPQ-NONO heteromer may be involved in DNA non-homologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. In vitro, the complex strongly stimulates DNA end joining, binds directly to the DNA substrates and cooperates with the Ku70/G22P1-Ku80/XRCC5 (Ku) dimer to establish a functional preligation complex. NONO is involved in transcriptional regulation. The SFPQ-NONO-NR5A1 complex binds to the CYP17 promoter and regulates basal and cAMP- dependent transcriptional activity. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Important for the functional organization of GABAergic synapses. Plays a specific and important role in the regulation of synaptic RNAs and GPHN/gephyrin scaffold structure, through the regulation of GABRA2 transcript. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS- STING pathway (PubMed:28712728). [The UniProt Consortium]
Schlagworte: Anti-NONO, Anti-NRB54, Anti-NMT55, Anti-p54nrb, Anti-p54(nrb), Anti-NonO protein, Anti-55 kDa nuclear protein, Anti-54 kDa nuclear RNA- and DNA-binding protein, Anti-DNA-binding p52/p100 complex, 52 kDa subunit
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40515

Eigenschaften

Anwendung: ICC, IF, IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Synthetic peptide around the C-terminal region of Human NONO / p54nrb. (within the following region: DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY)
MW: 54 kD
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-NONO / p54nrb"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen