Anti-NEDD8

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59010.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Ubiquitin-like protein which plays an important role in cell cycle control and... mehr
Produktinformationen "Anti-NEDD8"
Protein function: Ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis. Covalent attachment to its substrates requires prior activation by the E1 complex UBE1C- APPBP1 and linkage to the E2 enzyme UBE2M. Attachment of NEDD8 to cullins activates their associated E3 ubiquitin ligase activity, and thus promotes polyubiquitination and proteasomal degradation of cyclins and other regulatory proteins. [The UniProt Consortium]
Schlagworte: Anti-NEDD8, Anti-NEDD-8, Anti-Neddylin, Anti-Ubiquitin-like protein Nedd8, Anti-Neural precursor cell expressed developmentally down-regulated protein 8
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59010

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 20-60 of Human NEDD8 (TDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK)
MW: 9 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-NEDD8"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen