Anti-Myosin Phosphatase / PPP1R12A

Anti-Myosin Phosphatase / PPP1R12A
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31804 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PPP1R12A (Protein phosphatase 1 regulatory... mehr
Produktinformationen "Anti-Myosin Phosphatase / PPP1R12A"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. PPP1R12A (Protein phosphatase 1 regulatory subunit 12A), also called MYPT1 (Myosin phosphatase target subunit 1), is an enzyme that in humans is encoded by the PPP1R12A gene. PPP1R12A is one of the subunits of myosin phosphatase. Sequencing analysis showed that human PPP1R12A contains 1,030 amino acids with a calculated molecular mass of approximately 115 kD. The PPP1R12A gene is mapped on 12q21.2-q21.3. PPP1R12A is the protein that regulates PP1 function in smooth muscle relaxation. The cellular MYPT1-PP1-delta -specific inhibitor CPI17 caused a loss of merlin function characterized by merlin phosphorylation, Ras activation, and transformation. Jin et al. concluded that PPP1R12A and its substrate merlin are part of a previously undescribed tumor suppressor cascade that can be hindered in two ways, by mutation of the NF2 gene and by upregulation of the oncoprotein CPI17. Protein function: Key regulator of protein phosphatase 1C (PPP1C). Mediates binding to myosin. As part of the PPP1C complex, involved in dephosphorylation of PLK1. Capable of inhibiting HIF1AN- dependent suppression of HIF1A activity. [The UniProt Consortium]
Schlagworte: Anti-MBS, Anti-Myosin phosphatase target subunit 1, Anti-Myosin phosphatase-targeting subunit 1, Anti-Protein phosphatase myosin-binding subunit, Anti-Protein phosphatase 1 regulatory subunit 12A, Myosin Phosphatase Antibody / PPP1R12A
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31804

Eigenschaften

Anwendung: WB, IHC (paraffin), FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse
Immunogen: Amino acids MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDD of human PPP1R12A were used as the immunogen for the PPP1R12A antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-Myosin Phosphatase / PPP1R12A"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen