Anti-MYH6 / Myosin 6

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ6780 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Myosin heavy chain, alpha isoform... mehr
Produktinformationen "Anti-MYH6 / Myosin 6"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Myosin heavy chain, alpha isoform (MHC-alpha) is a protein that in humans is encoded by the MYH6 gene. Cardiac muscle myosin is a hexamer consisting of two heavy chain subunits, two light chain subunits, and two regulatory subunits. This gene encodes the alpha heavy chain subunit of cardiac myosin. The gene is located approximately 4kb downstream of the gene encoding the beta heavy chain subunit of cardiac myosin. Mutations in this gene cause familial hypertrophic cardiomyopathy and atrial septal defect 3. Protein function: Muscle contraction. [The UniProt Consortium]
Schlagworte: Anti-MYH6, Anti-MYHCA, Anti-Myosin-6, Anti-MyHC-alpha, Anti-Myosin heavy chain 6, Anti-Myosin heavy chain, cardiac muscle alpha isoform, MYH6 Antibody / Myosin 6
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ6780

Eigenschaften

Anwendung: WB, IHC (paraffin), FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids RTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQ from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MYH6 / Myosin 6"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen