Anti-MUC3

Anti-MUC3
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32385 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. MUC3 consists of two genes, MUC3A and... mehr
Produktinformationen "Anti-MUC3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. MUC3 consists of two genes, MUC3A and MUC3B, each encoding membrane-bound mucins possessing 2 epidermal growth factor-like domains. The MUC3 gene is mapped to chromosome 7. It was showed that synthetic peptide-mediated upregulation of MUC3 dramatically inhibited adherence of enteropathogenic E. coli or enterohemorrhage E. coli serotype O157:H7 to HT-29 human intestinal epithelial cells. Peptide stimulation altered expression of a number of transcription factors, including upregulation of SP1, CREB1, and CDX2. These transcription factors bound to consensus sites in the MUC3 promoter upon peptide stimulation and likely mediated MUC3 upregulation. Protein function: Major glycoprotein component of a variety of mucus gels. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. May be involved in ligand binding and intracellular signaling. [The UniProt Consortium]
Schlagworte: Anti-MUC-3A, Anti-Mucin-3A, Anti-Intestinal mucin-3A, MUC3 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32385

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK from human MUC3A/B were used as the immunogen for the MUC3 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MUC3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen