Anti-MORC3

Anti-MORC3
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG43058.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent... mehr
Produktinformationen "Anti-MORC3"
Protein function: Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism (PubMed:20501696). Sumoylated MORC3-NBs can also associate with PML-NBs (PubMed:20501696). Recruits TP53 and SP100 to PML-NBs, thus regulating TP53 activity (PubMed:17332504). Binds RNA in vitro (PubMed:11927593). May be required for influenza A transcription during viral infection (PubMed:26202233). Histone methylation reader which binds to non-methylated (H3K4me0), monomethylated (H3K4me1), dimethylated (H3K4me2) and trimethylated (H3K4me3) 'Lys-4' on histone H3 (PubMed:26933034). The order of binding preference is H3K4me3 > H3K4me2 > H3K4me1 > H3K4me0 (PubMed:26933034). [The UniProt Consortium]
Schlagworte: Anti-Nuclear matrix protein 2, Anti-Nuclear matrix protein 2, Anti-MORC family CW-type zinc finger protein 3, Anti-MORC family CW-type zinc finger protein 3, Anti-Zinc finger CW-type coiled-coil domain protein 3, Anti-Zinc finger CW-type coiled-coil domai
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG43058

Eigenschaften

Anwendung: FC, ICC, IF, WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human MORC3. (ESLKLRSLRVNVGQLLAMIVPDLDLQQVNYDVD)
MW: 107 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MORC3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen