Anti-MMP8

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31831 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. MMP8 (Matrix metalloproteinase 8) is a... mehr
Produktinformationen "Anti-MMP8"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. MMP8 (Matrix metalloproteinase 8) is a member of the family of matrix metalloproteinases. It is distinct from the collagenase of skin fibroblasts and synovial cells in substrate specificity and immunologic crossreactivity. MMP8 is mapped to 11q21-q22. MMP8 is an enzyme that degrades fibrillar collagens imparting strength to the fetal membranes, is expressed by leukocytes and chorionic cytotrophoblast cells. The enzyme exhibits 58% homology to human fibroblast collagenase and has the same domain structure. It consists of a 20-residue signal peptide, and an 80-residue propeptide that is lost on autolytic activation by cleavage of an M-L bond. MMP8 was found to possess 57% identity with the deduced protein sequence for fibroblast collagenase with 72% chemical similarity. Matrix metalloproteinases (MMPs) have fundamental roles in tumor progression, but most clinical trials with MMP inhibitors have not shown improvements in individuals with cancer. MMP8 has a paradoxical protective role in cancer and provides a genetic model to evaluate the molecular basis of gender differences in cancer susceptibility. Protein function: Can degrade fibrillar type I, II, and III collagens. May play a role in the degradation of collagen fibers during uterine involution. [The UniProt Consortium]
Schlagworte: Anti-Mmp8, Anti-MMP-8, EC=3.4.24.34, Anti-Collagenase 2, Anti-Neutrophil collagenase, Anti-Matrix metalloproteinase-8, MMP8 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31831

Eigenschaften

Anwendung: WB, IHC (paraffin), ELISA
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: mouse, rat
Immunogen: Amino acids HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD of mouse MMP8 were used as the immunogen for the MMP8 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MMP8"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen