Anti-MMP3

Anti-MMP3
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R31680 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Stromelysin-1, also known as Matrix... mehr
Produktinformationen "Anti-MMP3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Stromelysin-1, also known as Matrix metalloproteinase-3 (MMP-3), is an enzyme that in humans is encoded by the MMP3 gene. It is mapped to 11q22.2. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix and during tissue remodeling in normal physiological processes, such as embryonic development and reproduction, as well as in disease processes, such as arthritis, and tumour metastasis. The MMP3 enzyme degrades collagen types II, III, IV, IX, and X, proteoglycans, fibronectin, laminin, and elastin. In addition, it can also activate other MMPs such as MMP1, MMP7, and MMP9, rendering MMP3 crucial in connective tissue remodeling. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. Protein function: Can degrade fibronectin, laminin, gelatins of type I, III, IV, and V, collagens III, IV, X, and IX, and cartilage proteoglycans. Activates procollagenase. [The UniProt Consortium]
Schlagworte: Anti-SL-1, Anti-MMP3, Anti-MMP-3, Anti-STMY1, Anti-Transin-1, EC=3.4.24.17, Anti-Stromelysin-1, Anti-Matrix metalloproteinase-3, MMP3 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R31680

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: An amino acid sequence from the C-terminal of human MMP3 (RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA) was used as the immunogen for this MMP3 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MMP3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen