Anti-MLX / Max-like protein X

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ6889 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Max-like protein X is a protein that in... mehr
Produktinformationen "Anti-MLX / Max-like protein X"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Max-like protein X is a protein that in humans is encoded by the MLX gene. The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Protein function: Transcription regulator. Forms a sequence-specific DNA- binding protein complex with MAD1, MAD4, MNT, WBSCR14 and MLXIP which recognizes the core sequence 5'-CACGTG-3'. The TCFL4-MAD1, TCFL4-MAD4, TCFL4-WBSCR14 complexes are transcriptional repressors. Plays a role in transcriptional activation of glycolytic target genes. Involved in glucose-responsive gene regulation. [The UniProt Consortium]
Schlagworte: Anti-MLX, Anti-bHLHd13, Anti-BHLHD13, Anti-Protein BigMax, Anti-Max-like protein X, Anti-Max-like bHLHZip protein, Anti-Transcription factor-like protein 4, Anti-Class D basic helix-loop-helix protein 13, MLX Antibody / Max-like protein X
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ6889

Eigenschaften

Anwendung: WB, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, monkey
Immunogen: Amino acids FQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY from the human protein
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MLX / Max-like protein X"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen