Anti-MICA

Anti-MICA
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32255 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene encodes the highly polymorphic... mehr
Produktinformationen "Anti-MICA"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A. The protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. And the protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene results in multiple transcript variants. Protein function: Seems to have no role in antigen presentation. Acts as a stress-induced self-antigen that is recognized by gamma delta T-cells. Ligand for the KLRK1/NKG2D receptor. Binding to KLRK1 leads to cell lysis. [The UniProt Consortium]
Schlagworte: Anti-MIC-A, Anti-MHC class I polypeptide-related sequence A, MICA Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32255

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids QSHWQTFHVSAVAAAAKFVEIIFYVRCCKKK of human MICA
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MICA"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen