Anti-MEK3 / MAP2K3 / MKK3

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32106 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Dual specificity mitogen-activated protein... mehr
Produktinformationen "Anti-MEK3 / MAP2K3 / MKK3"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Dual specificity mitogen-activated protein kinase kinase 3 is an enzyme that in humans is encoded by the MAP2K3 gene. The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is activated by mitogenic and environmental stress, and participates in the MAP kinase-mediated signaling cascade. It phosphorylates and thus activates MAPK14/p38-MAPK. And this kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. Rampoldi et al. (1997) localized the MAP2K3 gene to 17q11.2. Protein function: Dual specificity kinase. Is activated by cytokines and environmental stress in vivo. Catalyzes the concomitant phosphorylation of a threonine and a tyrosine residue in the MAP kinase p38. Part of a signaling cascade that begins with the activation of the adrenergic receptor ADRA1B and leads to the activation of MAPK14. [The UniProt Consortium]
Schlagworte: Anti-MEK3, Anti-MEK 3, Anti-SAPKK2, Anti-MAP2K3, Anti-SAPKK-2, Anti-MAPKK 3, Anti-SAPK kinase 2, Anti-MAPK/ERK kinase 3, Anti-MAP kinase kinase 3, Anti-Stress-activated protein kinase kinase 2, MEK3 Antibody / MAP2K3 / MKK3
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32106

Eigenschaften

Anwendung: WB, IHC (paraffin), IF, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS of human MAP2K3/MEK3
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-MEK3 / MAP2K3 / MKK3"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen