Anti-LMO2 / Rhombotin 2

Anti-LMO2 / Rhombotin 2
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4423 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LIM domain only 2 (Rhombotin-like 1,... mehr
Produktinformationen "Anti-LMO2 / Rhombotin 2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. LIM domain only 2 (Rhombotin-like 1, Rhombotin 2), also known as LMO2, RBTNL1, RBTN2, RHOM2, TTG2, and T-Cell Translocation Protein 2, is a protein which in humans is encoded by the LMO2 gene. LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms. Protein function: Acts with TAL1/SCL to regulate red blood cell development. Also acts with LDB1 to maintain erythroid precursors in an immature state. [The UniProt Consortium]
Schlagworte: Anti-LMO2, Anti-RBTN2, Anti-LMO-2, Anti-Rhombotin-2, Anti-LIM domain only protein 2, Anti-Cysteine-rich protein TTG-2, Anti-T-cell translocation protein 2, LMO2 Antibody / Rhombotin 2
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4423

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids QKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI from the human protein were used as the immunogen for the LMO2 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-LMO2 / Rhombotin 2"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen