Anti-KIM-1 / TIM-1 / HAVCR1

Anti-KIM-1 / TIM-1 / HAVCR1
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32305 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Kidney injury molecule 1, also known as... mehr
Produktinformationen "Anti-KIM-1 / TIM-1 / HAVCR1"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Kidney injury molecule 1, also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the HAVCR1 gene. It may play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4 (By similarity). May play a role in kidney injury and repair. [UniProt] Protein function: May play a role in T-helper cell development and the regulation of asthma and allergic diseases. Receptor for TIMD4. May play a role in kidney injury and repair. [The UniProt Consortium]
Schlagworte: Anti-TIM, Anti-KIM1, Anti-KIM-1, Anti-TIM-1, Anti-TIMD-1, Anti-HAVCR1, Anti-HAVcr-1, Anti-Kidney injury molecule 1, Anti-T-cell membrane protein 1, Anti-Hepatitis A virus cellular receptor 1, Anti-T-cell immunoglobulin mucin receptor 1, KIM-1 Antibody / T
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32305

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD of human HAVCR1 were used as the immunogen for the KIM1 antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-KIM-1 / TIM-1 / HAVCR1"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen