Anti-KDM5B / Jarid1B

Anti-KDM5B / Jarid1B
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG59272.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a... mehr
Produktinformationen "Anti-KDM5B / Jarid1B"
Protein function: Histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code (PubMed:24952722, PubMed:27214403, PubMed:28262558). Does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. Demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. Acts as a transcriptional corepressor for FOXG1B and PAX9. Favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5 (PubMed:24952722). In contrast, may act as a tumor suppressor for melanoma. Represses the CLOCK-ARNTL/BMAL1 heterodimer-mediated transcriptional activation of the core clock component PER2. [The UniProt Consortium]
Schlagworte: Anti-CT31, Anti-KDM5B, Anti-PLU-1, Anti-RBP2-H1, Anti-JARID1B, EC=1.14.11.-, Anti-Cancer/testis antigen 31, Anti-Histone demethylase JARID1B, Anti-Lysine-specific demethylase 5B, Anti-Jumonji/ARID domain-containing protein 1B
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG59272

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat (Erwartet: bovine, dog, hamster, horse, monkey, rabbit)
Immunogen: Synthetic peptide corresponding to aa. 641-685 of Human KDM5B / Jarid1B. (DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELL)
MW: 176 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-KDM5B / Jarid1B"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen