Anti-JUND

Anti-JUND
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-RQ4433 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transcription factor JunD is a protein... mehr
Produktinformationen "Anti-JUND"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Transcription factor JunD is a protein that in humans is encoded by the JUND gene. The protein encoded by this intronless gene is a member of the JUN family, and a functional component of the AP1 transcription factor complex. This protein has been proposed to protect cells from p53-dependent senescence and apoptosis. Alternative translation initiation site usage results in the production of different isoforms. Protein function: Transcription factor binding AP-1 sites. [The UniProt Consortium]
Schlagworte: Anti-JUND, Anti-Transcription factor jun-D, JUND Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: RQ4433

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids TASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY from the human protein were used as the immunogen for the JUND antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-JUND"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen