Anti-IL6R (C-Terminal Region)

Anti-IL6R (C-Terminal Region)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32900 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Interleukin 6 receptor (IL6R), also known... mehr
Produktinformationen "Anti-IL6R (C-Terminal Region)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor. This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9. Protein function: Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis. [The UniProt Consortium]
Schlagworte: Anti-IL6R, Anti-gp80, Anti-CD126, Anti-IL-6RA, Anti-IL-6R 1, Anti-IL-6R-alpha, Anti-IL-6R subunit alpha, Anti-Membrane glycoprotein 80, Anti-IL-6 receptor subunit alpha, Anti-Interleukin-6 receptor subunit alpha, IL6R Antibody (C-Terminal Region)
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32900

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human
Immunogen: Amino acids 379-419 (LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPR) were used as the immunogen for the IL6R antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-IL6R (C-Terminal Region)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen