Anti-IKZF1 / Ikaros

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG40706.50 50 µg - -

6 - 14 Werktage*

520,00 €
 
Protein function: Transcription regulator of hematopoietic cell differentiation... mehr
Produktinformationen "Anti-IKZF1 / Ikaros"
Protein function: Transcription regulator of hematopoietic cell differentiation (PubMed:17934067). Binds gamma-satellite DNA (PubMed:17135265, PubMed:19141594). Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta- globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells. Confers early temporal competence to retinal progenitor cells (RPCs). Function is isoform-specific and is modulated by dominant-negative inactive isoforms (PubMed:17135265, PubMed:17934067). [The UniProt Consortium]
Schlagworte: Anti-IK1, Anti-IKZF1, Anti-DNA-binding protein Ikaros, Anti-Ikaros family zinc finger protein 1, Anti-Lymphoid transcription factor LyF-1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG40706

Eigenschaften

Anwendung: IHC (paraffin), WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 428-459 of Human Ikaros. (LKEEHRAYDLLRAASENSQDALRVVSTSGEQM)
MW: 58 kD
Format: Antigen Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-IKZF1 / Ikaros"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen