Anti-HuD / ELAVL4

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32036 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HuD, otherwise known as ELAV-like protein... mehr
Produktinformationen "Anti-HuD / ELAVL4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HuD, otherwise known as ELAV-like protein 4 or PNEM, is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is anRNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds toAU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity. Protein function: May play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3'-UTR. Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA. [The UniProt Consortium]
Schlagworte: Anti-HuD, Anti-HUD, Anti-ELAVL4, Anti-Hu-antigen D, Anti-ELAV-like protein 4, Anti-Paraneoplastic encephalomyelitis antigen HuD, HuD Antibody / ELAVL4
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32036

Eigenschaften

Anwendung: WB, IHC (paraffin)
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK of human ELAVL4/HuD were used as the immunogen for the HuD antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-HuD / ELAVL4"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen