Anti-hnRNP H

Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
ARG58940.50 50 µl - -

6 - 14 Werktage*

520,00 €
 
Protein function: This protein is a component of the heterogeneous nuclear ribonucleoprotein... mehr
Produktinformationen "Anti-hnRNP H"
Protein function: This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates pre-mRNA alternative splicing regulation. Inhibits, together with CUGBP1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Binds to the IR RNA. Binds poly(RG). [The UniProt Consortium]
Schlagworte: Anti-HNRPH, Anti-HNRNPH1
Hersteller: Arigo Biolaboratories
Hersteller-Nr: ARG58940

Eigenschaften

Anwendung: ICC, IF, IHC (paraffin), IP, WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human (Erwartet: mouse, rat, bovine, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the middle region of Human hnRNP H. (within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG)
MW: 49 kD
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-hnRNP H"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen