Anti-HNF1B

Anti-HNF1B
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32080 100 µg - -

3 - 10 Werktage*

755,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HNF1 homeobox B (hepatocyte nuclear factor... mehr
Produktinformationen "Anti-HNF1B"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HNF1 homeobox B (hepatocyte nuclear factor 1 homeobox B), also known as HNF1B or transcription factor 2 (TCF2), is a human gene. It is a member of the homeodomain-containing superfamily of transcription factors. This gene is mapped to 17q12. The HNF1B protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1. HNF1B functions as both a classic transcriptional activator and as a bookmarking factor that marks target genes for rapid transcriptional reactivation after mitosis. HNF1B also can regulate renal tubulogenesis by controlling expression of SOC3. Mutation of HNF1B that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5). Protein function: Transcription factor, probably binds to the inverted palindrome 5'-GTTAATNATTAAC-3'. [The UniProt Consortium]
Schlagworte: Anti-TCF2, Anti-HNF1B, Anti-vHNF1, Anti-TCF-2, Anti-HNF-1B, Anti-HNF-1-beta, Anti-Homeoprotein LFB3, Anti-Transcription factor 2, Anti-Hepatocyte nuclear factor 1-beta, Anti-Variant hepatic nuclear factor 1, HNF1B Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32080

Eigenschaften

Anwendung: WB
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, rat
Immunogen: Amino acids AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT of human HNF1 beta were used as the immunogen for the HNF1 beta antibody.
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: -20°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-HNF1B"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen