Anti-HMGB1 (High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMG1)

Anti-HMGB1 (High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMG1)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
127955.100 100 µg - -

3 - 19 Werktage*

715,00 €
 
DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds... mehr
Produktinformationen "Anti-HMGB1 (High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMG1)"
DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type cytoplasmic processes in developing cells. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Hersteller: United States Biological
Hersteller-Nr: 127955

Eigenschaften

Anwendung: ELISA, IF, IHC, WB
Antikörper-Typ: Monoclonal
Klon: 1D5
Konjugat: No
Wirt: Mouse
Spezies-Reaktivität: human
Immunogen: Full length recombinant corresponding to aa1-215 from human HMGB1 (AAH03378.1) with GST tag. MW of the GST tag alone is 26kD.
Reinheit: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: +4°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-HMGB1 (High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMG1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen